2023-10-07_00000091_1_19 Domain 4 Parse 1 Confidence: 0.31

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
555624CompleteStructure predictionRoseTTAFold2023-10-07_00000091_1_1912147 Oct 2023-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
550427410.31comparative modeling535-6461127 Oct 2023
                540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    . 
   sequence: GLPEDYTGVVQVRGELADPEGNVYAGLKGTVIVDPRAKEDFLNLNDLYRGDTVVDGKKYTKEEVDALIREKLKTGALQLNLGIHRVSTVEEAKVGKQVFLRHMGGVPFNRGR
    psipred: -------EEEEEE---------EEE-----EEE---HHHHH--HHHH----EEE------HHHHHHHHHHHHH---EEEE--EEEE-HHHHHHHHHHHHHHHH---------
    spider3: ---------EEEE-EE------EEE----EEEE------------HH----EE----EE-HHHHHHHHHHHHHH-HHHH---EEEEEEEHHHHH-HEEEHHH----------
 deepconcnf: --------EEEEEEEEE-----EEEEEEEEEEE------------------EEE--EE--HHHHHHHHHHHHHH---EEEEEEEE----HH-----EEEE------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington