2023-10-07_00000186_1_19 Domain 6 Parse 1 Confidence: 0.74

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
555634CompleteStructure predictionRoseTTAFold2023-10-07_00000186_1_1913377 Oct 2023-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
550449610.74comparative modeling1040-11541157 Oct 2023
                  . 1050    . 1060    . 1070    . 1080    . 1090    . 1100    . 1110    . 1120    . 1130    . 1140    . 1150    
   sequence: ADGGKTLRACAANVDQISFLEPINLKFLQGESPFSITFSVYHESTSRTDQYTIDNIDSENFSFEKLYEGMKLGNHAITIDSVVDANGCVNSLISGPRNQILVSITDAPKIHILDP
 deepconcnf: --------------------EEEEEEE------EEEEEEEEE-----EEEEEEEEE---EEEEEE-------EEEEEEEEEEE-----EEE-------EEEEEEEE--EEEE---
    psipred: ----------------------EEEEE------EEEEEEEEE------EEEEEE------EEEE----------EEEEEEEEE---------------EEEEEEE---EEEE---
    spider3: --------E-------------EEEEE------EEEEEEEEE-----EEEEEEE------EEEEE--------EEEEEEEEEEE----E----------EEEEE----EEEE---
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington