2023-10-07_00000186_1_11 Domain 3 Parse 1 Confidence: 0.01

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
555633CompleteStructure predictioncameo2023-10-07_00000186_1_1113377 Oct 2023-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
550455310.01comparative modeling247-335897 Oct 2023
              250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
   sequence: ENTAMFNPLHESYCLPMDTNLFKINSIDVPIRINSTEEIEYIELEYRDLYTNSVELRSLSKKDFKIIDNPKSFLKKDQSVLKSHSNDFE
 deepconcnf: -------------------------EEEEEEEE-----EEEEEEEEEE----EEEEEE--HHHHHH------HHH--HHHHHH------
    psipred: -------------EE-----------EEEEEEE-------EEEEEEE------HHHHHHHHHHHHHH--HHHHHHHHHHHHHH------
    spider3: ------------EE------------EEEEEEE-------EEEEEEE------EEEEEE-HHHEEEE--HHH------EE---------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington