2023-10-07_00000186_1_11 Domain 4 Parse 1 Confidence: 0.79

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
555633CompleteStructure predictioncameo2023-10-07_00000186_1_1113377 Oct 2023-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
550456410.79comparative modeling329-4421147 Oct 2023
                   .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440  
   sequence: SHSNDFEEGSTIRYLAVTLQDIGFYQIKKIVDSKKLNLKIHQSHLVVPYCPIASITGTGSNDRCIGDSDNVSFEIQGVPPMKLAYSKIVNGQTFSYVDSSLQPEYFESPLQSSK
 deepconcnf: -----------EEEEEEEE---EEEEEEEEEE----EEEE---EEEEE-----EE---------------EEEEEEE---EEEEEEEEE--EEEEEEEEE--------------
    psipred: -----------EEEEEEE----EEEEEEEEEE----EEEE----EEEE----EEEE--------------EEEEEEE---EEEEEEEEE--EEEEEEE----------------
    spider3: -----------EEEEEEEE---EEEEEEEEE-----EEEE-HHHEEE----EEEEE------EE-------EEEEEE---EEEEEEEEE--EEEEEEEEE--------------
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington