| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 557517 | Complete | Structure prediction | RoseTTAFold | 2023-10-21_00000000_1_19 | 72 | 21 Oct 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 552257 | 1 | 1 | 0.68 | RoseTTAFold | 1-72 | 72 | 21 Oct 2023 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: AMRKDAKAPYVTVFDERDGCGGPTKAGGNSGDNKGLCVKVAMKKVAYGEGGVDRIGEMARDVFVNYDKQRGK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington