2023-10-21_00000104_3_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 557529 | Complete | Structure prediction | RoseTTAFold | 2023-10-21_00000104_3_19 | 67 | 21 Oct 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 552265 | 1 | 1 | 0.86 | RoseTTAFold | 21-67 | 47 | 21 Oct 2023 |
. 30 . 40 . 50 . 60 .
sequence: GLKGPLYFPPADKNAPPPTKPVETQTQSTVPDKNDRATGDGPSQVNY
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington