2023-12-02_00000041_2_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 571043 | Complete | Structure prediction | RoseTTAFold | 2023-12-02_00000041_2_19 | 69 | 2 Dec 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 565608 | 1 | 1 | 0.90 | RoseTTAFold | 1-69 | 69 | 2 Dec 2023 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: MTNPFDNEDGSFLVLVNGEGQHSLWPAFAEVPDGWTGVHGPASRQDCLGYVEQNWTDLRPKSLISQISD
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington