2024-01-13_00000273_2_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 581316 | Complete | Structure prediction | RoseTTAFold | 2024-01-13_00000273_2_19 | 64 | 13 Jan 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 575620 | 1 | 1 | 0.65 | RoseTTAFold | 1-64 | 64 | 13 Jan 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: VLTDKLCGKDLVDALLLVCGEKGVYSPKMGYARAKTVKGNGIADVCCTSANGCDLNFLEKFCKT
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington