2024-03-02_00000281_2_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 599212 | Error | Structure prediction | cameo | 2024-03-02_00000281_2_11 | 69 | 2 Mar 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 593431 | 1 | 1 | n/a | TrRefineRosetta | 1-69 | 69 | 2 Mar 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: STAAVTGQTGLTITYPASATESAAIQGTFGNSAAIKIKNQTLTWTRTPEGAWSCATTVEAKFKPAGCAS
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington