2024-03-16_00000118_3_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 602974 | Error | Structure prediction | cameo | 2024-03-16_00000118_3_11 | 33 | 16 Mar 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 597204 | 1 | 1 | n/a | TrRefineRosetta | 1-33 | 33 | 16 Mar 2024 |
1 . 10 . 20 . 30
sequence: ASTPPASAFLKAWVYRPGEDTEEEEDEDVDSED
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington