HBsAg Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
604862 | Expired | Structure prediction | SongXue | HBsAg | 71 | 21 Mar 2024 | 5 May 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
599113 | 1 | 1 | 0.53 | RoseTTAFold | 1-71 | 71 | 21 Mar 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: DYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASAR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington