2024-03-23_00000227_1_11 Domain 7 Parse 1 Confidence: 0.06

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
606166CompleteStructure predictioncameo2024-03-23_00000227_1_11120323 Mar 2024-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
600723710.06comparative modeling841-9329224 Mar 2024
                 .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930  
   sequence: GKQKPKQLLPPPTKGVSSDDDSQHNRSTAKSVSGRQFVPSLGSVSEVDHSTGEEQSSDSESTTSSLPPKLSLRQRFLVCIGWADPNKYGRHD
 deepconcnf: ------------------------------------E--------------------------------------EEEEE------------
    psipred: ----------------------------------------------------HH-----------------HHHHHEEEE----HHH-----
    spider3: -----------------------------------------------------------------------HHHHHHHHHHH----------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington