Matthias Class Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
610714 | Expired | Structure prediction | masauer2 | Matthias Class | 59 | 2 Apr 2024 | 17 May 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
604976 | 1 | 1 | 0.89 | RoseTTAFold | 1-59 | 59 | 2 Apr 2024 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington