golga4 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 611123 | Complete | Structure prediction | liqi | golga4 | 63 | 6 Apr 2024 | 21 May 2024 (61:18:34) |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 605343 | 1 | 1 | 0.70 | RoseTTAFold | 1-63 | 63 | 6 Apr 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: YLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDADYKDHDGDYKDHDIDYKDDDK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington