LL-37-Mutation Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
611180 | Complete | Structure prediction | pwilcox2 | LL-37-Mutation | 37 | 6 Apr 2024 | 21 May 2024 (28:24:04) |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
605417 | 1 | 1 | 0.88 | RoseTTAFold | 1-37 | 37 | 6 Apr 2024 |
1 . 10 . 20 . 30 .
sequence: LLGDFFRKSKEKSGKEFKRIVQRIKDFLRNLVPDTES
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington