model_4. Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
613218CompleteStructure prediction 18004328023model_4.17018 Apr 20242 Jun 2024
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
607416110.46RoseTTAFold1-17017018 Apr 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
   sequence: GSAGSAAGSGEFAVVRFQEAANKQKQEGSAGSAAGSGEFKQSLTKLAAAWGGSGGSAGSAAGSGEFSATYQSAIPPRGTQAGSAGSAAGSGEFIRQAGVQYSRADEEQQQALSSGSAGSAAGSGEFSEAYQGVQQKWDAGSAGSAAGSGEFSKQTGQQVSIAPNAGLDPV
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington