example_template.txt Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
613905CompleteStructure prediction dalpizar91example_template.txt28324 Apr 20248 Jun 2024
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
60807911n/acomparative modeling1-28328324 Apr 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280   
   sequence: DQRRPLKVLSLFDGIATGYLVLKDLGFKIERYIASEICDDSIAVGMIKHEGKIEYVNDVRTITRKHLAEWGPFDLLIGGSPCNDLSMVNPLRKGLFEGTGRLFFEFYRILTMLKPKEGDDRPFFWLFENVVFMSAHDKSDICRFLECNPILIDAVKVSPAHRARYFWGNLPGMNRPLATALDDKVALQDCLESGRKAKVDKVRTITTKSNSLRQGKMGLPVNMNGKEDYLWCTELEQIFGFPKHYTDVNNMGRSQRQRVLGRSWSVPVIRHLFAPLKDYYECE
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington