| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 615717 | Error | Structure prediction | cameo | 2024-05-04_00000165_1_11 | 49 | 4 May 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 609870 | 1 | 1 | n/a | TrRefineRosetta | 1-49 | 49 | 4 May 2024 |
1 . 10 . 20 . 30 . 40 .
sequence: LSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTF
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington