wi2 Domain 1 Parse 1 Confidence: 0.32

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
617458CompleteStructure prediction Robin79wi214815 May 20245 Aug 2024
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
611603110.32comparative modeling1-14814815 May 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .   
   sequence: AAIRCYVCDSSDNPSCADLGSNSSIVAEECTLDKMKSLDTWLFDLNKFSYFDNGANKSPLMNCQKVVAKDPDTRKVVTARFCQLDTGDSDACEILRTKLRIPSPEEREQRNRNQNKRRKGHGQDAEEDDEISAEDAFFCGICKSHRCN
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington