2024-05-25_00000212_2_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 618360 | Complete | Structure prediction | RoseTTAFold | 2024-05-25_00000212_2_19 | 47 | 25 May 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 612471 | 1 | 1 | 0.74 | RoseTTAFold | 1-47 | 47 | 25 May 2024 |
1 . 10 . 20 . 30 . 40 .
sequence: GHMKGILKNRARRERPGKRKTVTWPEEGKLREYFYFELDETERVNVN
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington