sox9 Domain 1 Parse 1 Confidence: 0.11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
617467ActiveStructure predictionnallabolu.v@northeastern.edusox950915 May 202413 Jul 2024
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
613309110.11comparative modeling1-979729 May 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  
   sequence: MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKGYDWTLVPMPVRVNG
    psipred: -----HH----HHHH---------------------------------------------------------HHHHHHHHH-----EE----EE---
    spider3: ------------------------------------------------------------------------HHHHHHHH-----------------
 deepconcnf: -----------HHHH-------------------------------------------------------HHHHHHHHHHH-----EE---------
Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington