| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 622049 | Error | Structure prediction | cameo | 2024-06-29_00000032_1_11 | 55 | 29 Jun 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 616038 | 1 | 1 | n/a | TrRefineRosetta | 1-55 | 55 | 29 Jun 2024 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: GPMPGKKVVARVVELLHDPARNAPVARVRFEDGEERLILVPEGVKVGDVVEVKKV
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington