essD.fasta Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 626478 | Expired | Structure prediction | vigneshsivaguru | essD.fasta | 71 | 20 Jul 2024 | 8 Sep 2024 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 620196 | 1 | 1 | 0.82 | RoseTTAFold | 1-71 | 71 | 20 Jul 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: MKSMDKLTTGVAYGTSAGSAGYWFLQLLDKVTPSQWAAIGVLGSLVFGLLTYLTNLYFKIKEDKRKAARGE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington