2021-03-20_00000090_1_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 63877 | Complete | Structure prediction | cameo | 2021-03-20_00000090_1_11 | 110 | 20 Mar 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 62196 | 1 | 1 | 0.75 | TrRefineRosetta | 1-104 | 104 | 20 Mar 2021 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
sequence: GDADKIMEQAKRQDPNAQVYKVTTPDEIEEAVRRIEKYGAQVVLIIYTSSGIVILVAVRDPSQADQILKEAKKQNPSATFVRLEGVSPDDLRRQVEDVWRGSLE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington