2021-03-20_00000113_2_11 Domain 3 Parse 1 Confidence: 0.90

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
63881CompleteStructure predictioncameo2021-03-20_00000113_2_11121820 Mar 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
62255310.90comparative modeling824-93311020 Mar 2021
              .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930   
   sequence: KHMEPLGTDDDFWGPSGPVSTEVVDRERNLYRVRLPMAGSYHCPSTGLHFVVTRAVTIEIGFCAWSQFLHETPLQHSHMVAGPLFDIKAEHGAVTAVCLPHFVSLQEGKV
 deepconcnf: --------------------EEEEE----EEEEE----EEEE-----EEEEE---EEEEEEEEE--HHH---------EEE--EEEEEEE---EEEEE---EEE------
    psipred: ------------------EEEEEE-----EEEEE------EE-----EEEEEEEEEEEEEEEE--HHHHHH-------EEE---EEEEE----EEEEE---EEE------
    spider3: ---------------------EEE-----EEEEEE---EEEE------EEEE---EEEEEEEE-HHHHHH-------EEEE----EEEE----EEEEE--EEEEE-----
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington