2024-07-27_00000166_1_19 Domain 3 Parse 1 Confidence: 0.07

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
626924CompleteStructure predictionRoseTTAFold2024-07-27_00000166_1_19124127 Jul 2024-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
622742310.07comparative modeling223-2906816 Aug 2024
               .  230    .  240    .  250    .  260    .  270    .  280    .  290
   sequence: WSPSASYDLRERLCPGSALGNPGGPEQQVPTDEAEAQMLGSADLDDMKSHRLEDNPGVRRHLVKKPSR
    psipred: --------HHH---------------------HHHHH-HH------HHH---------EEE-------
    spider3: --------HHH---------------------HHHHHHHHH---------------------------
 deepconcnf: --------------------------------HHHHHHH----HHHHHH-------------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington