2024-09-21_00000044_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 633839 | Complete | Structure prediction | RoseTTAFold | 2024-09-21_00000044_1_19 | 35 | 21 Sep 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 627608 | 1 | 1 | 0.79 | RoseTTAFold | 1-35 | 35 | 21 Sep 2024 |
1 . 10 . 20 . 30 .
sequence: STKNILYAVMALLGELEDEDLVYVRREIEQRIGGR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington