AF-P13068-F1-model_v4.pdb Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 635164 | Expired | Structure prediction | Andal | AF-P13068-F1-model_v4.pdb | 35 | 3 Oct 2024 | 17 Nov 2024 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 628920 | 1 | 1 | n/a | comparative modeling | 1-35 | 35 | 3 Oct 2024 |
1 . 10 . 20 . 30 .
sequence: ITSISLCTPGCKTGALMGCNMKVYIPRPRPPHPRL
>628920
ITSISLCTPGCKTGALMGCNMKVYIPRPRPPHPRL
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 0.6571 startpos: 1
ITSISLCTPGCKTGALMGCNMKTATCHCSI-HVSK
Powered by MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington