cvnFACHB-973 Domain 1 Parse 1 Confidence: 0.78

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
636589CompleteStructure prediction liorlesscvnFACHB-97312814 Oct 202428 Nov 2024
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
630313110.78comparative modeling1-12812814 Oct 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .   
   sequence: MLKICVTFLCAIFLSFNMAIANAWATGEFSRTCENISVEGSTLTASCEKADGYTLSTTSIDLNPYIANLDGTLSWDGDKFALTCGNIGLAGTNRLRAECERADGETYLGTYINLDDHIANIDGKLKFE
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington