ALKL2_HUMAN ALK and LTK ligand Domain 1 Parse 1 Confidence: 0.49

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
636721ExpiredStructure prediction NithyaALKL2_HUMAN ALK and LTK l...15214 Oct 202428 Nov 2024
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
630447110.49comparative modeling1-15215214 Oct 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150  
   sequence: MRGPGHPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington