Cra_B_AP00539 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
636792 | Expired | Structure prediction | Vincent_Lee | Cra_B_AP00539 | 38 | 14 Oct 2024 | 28 Nov 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
630514 | 1 | 1 | 0.88 | RoseTTAFold | 1-38 | 38 | 14 Oct 2024 |
1 . 10 . 20 . 30 .
sequence: GFGCPWNRYQCHSHCRSIGRLGGYCAGSLRLTCTCYRS
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington