Dro_A_AP01564 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
636844 | Expired | Structure prediction | Vincent_Lee | Dro_A_AP01564 | 40 | 15 Oct 2024 | 29 Nov 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
630566 | 1 | 1 | 0.80 | RoseTTAFold | 1-40 | 40 | 15 Oct 2024 |
1 . 10 . 20 . 30 . 40
sequence: ATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington