Pyr_B_AP03459 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
636946 | Expired | Structure prediction | Vincent_Lee | Pyr_B_AP03459 | 43 | 15 Oct 2024 | 29 Nov 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
630667 | 1 | 1 | 0.78 | RoseTTAFold | 1-43 | 43 | 15 Oct 2024 |
1 . 10 . 20 . 30 . 40
sequence: ATCDILSFQSQWVTPNHAGCALHCVIKGYKGGQCKITVCHCRR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington