Hom_A_AP02819 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 637076 | Expired | Structure prediction | Vincent_Lee | Hom_A_AP02819 | 51 | 16 Oct 2024 | 30 Nov 2024 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 630796 | 1 | 1 | 0.80 | RoseTTAFold | 1-51 | 51 | 16 Oct 2024 |
1 . 10 . 20 . 30 . 40 . 50
sequence: GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington