Ana_B_AP00198 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
637084 | Complete | Structure prediction | Vincent_Lee | Ana_B_AP00198 | 64 | 16 Oct 2024 | 30 Nov 2024 (42:40:27) |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
630804 | 1 | 1 | 0.80 | RoseTTAFold | 1-64 | 64 | 16 Oct 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: MRILYLLFSVLFLVLQVSPGLSLPQRDMFLCRIGSCHFGRCPIHLVRVGSCFGFRSCCKSPWDV
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington