B3 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
637569 | Complete | Structure prediction | gret4 | B3 | 99 | 20 Oct 2024 | 4 Dec 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
631264 | 1 | 1 | 0.87 | RoseTTAFold | 1-99 | 99 | 20 Oct 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 .
sequence: YIQVALGWTAMHRKRLYIPLAFASLCFEKKAQTVILWVGEQNWRVNLTVTRSRSGSEYHFSGGWSAFARENCLQQNDVCIFELIQRIQPQIKVTIFRQI
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington