usp 16 -first coiled coil domain Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 637666 | Complete | Structure prediction | Asal | usp 16 -first coiled coil... | 50 | 21 Oct 2024 | 5 Dec 2024 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 631355 | 1 | 1 | 0.84 | RoseTTAFold | 1-50 | 50 | 21 Oct 2024 |
1 . 10 . 20 . 30 . 40 . 50
sequence: DYVRKQASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENMAKENP
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington