line10 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
637883 | Complete | Structure prediction | katafotic | line10 | 60 | 22 Oct 2024 | 6 Dec 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
631561 | 1 | 1 | 0.79 | RoseTTAFold | 1-60 | 60 | 22 Oct 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: RILRPMCFVKQLEVPPYGSYRPNVAPATPRANLAKELEKFSKVTFDYASFDAQVFGKRML
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington