test3 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 637969 | Complete | Structure prediction | patri | test3 | 116 | 22 Oct 2024 | 6 Dec 2024 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 631647 | 1 | 1 | 0.77 | RoseTTAFold | 1-116 | 116 | 22 Oct 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 .
sequence: MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDDQPPRT
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington