0417-PLE Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
638386CompleteStructure prediction gsdsdt0417-PLE10024 Oct 20248 Dec 2024
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
632040110.91RoseTTAFold1-10010024 Oct 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
   sequence: AAKITGRVYEPQTGEVREFEVDAAASEEEIAKKVLEVLREVVERGVDCVVEIKAEGLTDERAERIVKAIEEAVKAAGLEITDLKAEKKEGTFTITLTIKA
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington