2024-10-05_00000099_1_19 Domain 4 Parse 1 Confidence: 0.52

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
635478ErrorStructure predictionRoseTTAFold2024-10-05_00000099_1_1915305 Oct 2024-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
632109410.52comparative modeling1465-15306625 Oct 2024
               1470    . 1480    . 1490    . 1500    . 1510    . 1520    . 1530
   sequence: SPKGMMKLCSAFACPTSNLQIIGLWKWQYPVQIRKLLEEVQLLKPRVVIDGSWHSFDEDDRYWWKN
    psipred: ---HHHHHHHHH-------EEEE-------HHHHHHHHHHH-------EEE---------------
    spider3: --HHHHHHHHHH--------EEEEE-----HHHHHHHHHHHHH-----EEE---------------
 deepconcnf: --HHHHHHHHHH------EEEEEE------HHHHHHHHHHHHH----EEEE---------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington