1A3S-4-NEM Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
638956 | Complete | Structure prediction | gsdsdt | 1A3S-4-NEM | 158 | 30 Oct 2024 | 14 Dec 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
632587 | 1 | 1 | 0.89 | RoseTTAFold | 1-158 | 158 | 30 Oct 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 .
sequence: MVGKAELKWRSQETQYKRAHPPGFKIRAEPAPDTSADYFAWNGAVPGIPGTLFENGFFRFLVTLSDSYPEQPPRIAVIPPLLHPNVRADGRIHFPVLTPDKGWNSEITLEAVLRNIRELLGTPDPENPANKTAAEVFRNDDDLFKDITEEQSAAHRPS
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington