1esr-PLE-1 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 639207 | Complete | Structure prediction | gsdsdt | 1esr-PLE-1 | 76 | 31 Oct 2024 | 15 Dec 2024 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 632826 | 1 | 1 | 0.66 | RoseTTAFold | 1-76 | 76 | 31 Oct 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: SELELKPITEAEEANTEAIDPEEATDWYEVTDPSSKREAVRFRTKDGEVVPADPSDENVKRNIRKLRELAKLSKPK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington