Bacterioferritin-associated ferredoxin OS=Mycobacterium tuberculosis Domain 1 Parse 1 Confidence: 0.69
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 639225 | Complete | Structure prediction | SianD | Bacterioferritin-associat... | 72 | 31 Oct 2024 | 17 Dec 2024 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 632846 | 1 | 1 | 0.69 | ab initio | 1-72 | 72 | 31 Oct 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: MLMYVCLCVGVTNQTVCDAVARGASTSKEVAAVCGAGGDCGRCRRTLRAIIAAARLNPTQLDPAGRTSDAVC
deepconcnf: --EEEE------HHHHHHHHH-----HHHHHHHH--------HHHHHHHHHHHHH-----------------
psipred: --EEEEE-----HHHHHHHHHH----HHHHHHH---------HHHHHHHHHHHHHH----------------
spider3: ---EE------EHHHHHHHHH-----HHHHHHH--------HHHHHHHHHHHHHH-----------------
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington