6exy-PLE-1 Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
639250CompleteStructure prediction gsdsdt6exy-PLE-113831 Oct 202415 Dec 2024
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
632870110.92RoseTTAFold1-13813831 Oct 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .   
   sequence: LLEEPLELPLPGGLKPKTVIEIKGKVKEGAKSLRLELRYKDDIAFLLEFLFDENGKRVLRARVLKDGVWLEDLVLEEFLLEEGKEFTIRIEVKEDKLVVYVNEKRLLEVPYFFKNLEEIDTLRISGDIELLSASSFEK
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington