9fxf-NEM-4 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 639290 | Complete | Structure prediction | gsdsdt | 9fxf-NEM-4 | 120 | 31 Oct 2024 | 15 Dec 2024 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 632908 | 1 | 1 | 0.89 | RoseTTAFold | 1-120 | 120 | 31 Oct 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120
sequence: MYSLKPSGGGEVAPGGSVILSCAIAGFKLKEYDAGFIRHRPGEKPQPLSVYYPGNNSTFHNPKWKGRVSPTTDVPRRELTLVINNLTKADSAWYYCRGSPNDGRALCSNYSGDSADLNVN
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington