1a5p-PN-2 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
640006 | Complete | Structure prediction | gsdsdt | 1a5p-PN-2 | 124 | 5 Nov 2024 | 20 Dec 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
633610 | 1 | 1 | 0.93 | RoseTTAFold | 1-124 | 124 | 5 Nov 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120
sequence: SLSPVERFRREHLRPDVPAPPDENFCNREVRRRGLCVDSCKPQVVFIHAPWETVAAICTQERVPCSDGSTDCYLSREPLPLTVCTLTPDSKFPNCKYKTVGLRARIVVRCAGDPFLPVAFDGYV
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington