1txq-PLE-1 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 641660 | Complete | Structure prediction | gsdsdt | 1txq-PLE-1 | 74 | 12 Nov 2024 | 27 Dec 2024 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 635245 | 1 | 1 | 0.91 | RoseTTAFold | 1-74 | 74 | 12 Nov 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: AELKVGSRVKVKGLGEEGVVTYVGQTSVKEGEWVYVSLIEEKGDTDGTVNGETLFTTKKGYGKLLKKEEVEVEA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington