7nq8-NE-1 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 641724 | Complete | Structure prediction | gsdsdt | 7nq8-NE-1 | 111 | 12 Nov 2024 | 27 Dec 2024 (18:56:11) |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 635306 | 1 | 1 | 0.91 | RoseTTAFold | 1-111 | 111 | 12 Nov 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110
sequence: MGSKIQAYADELLLILLSPKYAAFGWPFLNPVDCAEANLFDYNKIVKEPMDLQTIKAKLAKNEAKDPGEFKEDILLAFDNCLIYNPPDSKIVKGARVINVEFDSAWASLPP
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington