1gka-PLE-1 Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
641758 | Complete | Structure prediction | gsdsdt | 1gka-PLE-1 | 175 | 12 Nov 2024 | 27 Dec 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
635341 | 1 | 1 | 0.84 | RoseTTAFold | 1-175 | 175 | 12 Nov 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 .
sequence: MGIPEAAREGPAAEVEAEEDFDLEKLGGVWAVVAVTPTPWLRAKRGLIGRLEVDKERREFRETLGGMDEDGNWLLDDRRVEPTAEAPPAVRRELGAGVPPRPLVLVKTDYEKWACLYSAVALGDRRVEEAFILGTDADPDGEAVKTCTKVLAEAGVPPERLVRVEIGEDTRAEVR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington